PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID mrna09406.1-v1.0-hybrid
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family MYB
Protein Properties Length: 192aa    MW: 21606.4 Da    PI: 8.295
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
mrna09406.1-v1.0-hybridgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding50.54.6e-161360148
                             TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
          Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                             +g+W+++Ede+l ++++++G g+W++ +   g+ R++k+c++rw +yl
  mrna09406.1-v1.0-hybrid 13 KGAWSKQEDEKLTQYIQKHGEGSWRSLPVAAGLLRCGKSCRLRWVNYL 60
                             79******************************99************97 PP

2Myb_DNA-binding54.43e-1766111148
                              TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
          Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                              rg++ ++E++l+++++++lG++ W++Ia +++ gRt++++k++w+++l
  mrna09406.1-v1.0-hybrid  66 RGNFGEDEEDLIIKLHALLGNR-WSLIAGRLP-GRTDNEVKNYWNTHL 111
                              89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.606.2E-22462IPR009057Homeodomain-like
PROSITE profilePS5129413.44860IPR017930Myb domain
SuperFamilySSF466891.14E-2812107IPR009057Homeodomain-like
SMARTSM007173.6E-121262IPR001005SANT/Myb domain
PfamPF002491.3E-141360IPR001005SANT/Myb domain
CDDcd001672.36E-91560No hitNo description
PROSITE profilePS5129426.44461115IPR017930Myb domain
Gene3DG3DSA:1.10.10.605.2E-2663116IPR009057Homeodomain-like
SMARTSM007171.9E-1665113IPR001005SANT/Myb domain
PfamPF002496.3E-1666111IPR001005SANT/Myb domain
CDDcd001672.62E-1168111No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009005anatomyroot
PO:0007134developmental stagesporophyte vegetative stage
Sequence ? help Back to Top
Protein Sequence    Length: 192 aa     Download sequence    Send to blast
MRKPCCEKKT TNKGAWSKQE DEKLTQYIQK HGEGSWRSLP VAAGLLRCGK SCRLRWVNYL  60
RPDLKRGNFG EDEEDLIIKL HALLGNRWSL IAGRLPGRTD NEVKNYWNTH LRRKLMHLGI  120
DPNNHRIGHN ICLNKQVNHP CKSANSQANN DDADDSDDPL LDSTSSGPES NISCSLPDLN  180
LDLTIGLPWS L*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C3e-281211526128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004299543.11e-139PREDICTED: myb-related protein 308-like
SwissprotP813933e-77MYB08_ANTMA; Myb-related protein 308
TrEMBLD9ZJ541e-109D9ZJ54_MALDO; MYB domain class transcription factor
STRINGPOPTR_0010s12420.14e-89(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF26434221
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38620.11e-73myb domain protein 4